SVIL, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-540	50 μL

Catalog No. 89-105-540 Supplier Abnova Corporation Supplier No. H00006840A01

Description

Mouse polyclonal antibody raised against a partial recombinant SVIL.

This gene encodes a bipartite protein with distinct amino- and carboxy-terminal domains. The amino-terminus contains nuclear localization signals and the carboxy-terminus contains numerous consecutive sequences with extensive similarity to proteins in the gelsolin family of actin-binding proteins, which cap, nucleate, and/or sever actin filaments. The gene product is tightly associated with both actin filaments and plasma membranes, suggesting a role as a high-affinity link between the actin cytoskeleton and the membrane. The encoded protein appears to aid in both myosin II assembly during cell spreading and disassembly of focal adhesions. Two transcript variants encoding different isoforms of supervillin have been described. [provided by RefSeq

Sequence: LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKG

Specifications

• Antigen: SVIL
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SVIL.
• Formulation: 50% glycerol
• Gene: SVIL
• Gene Accession No.: NM_003174
• Gene Alias: DKFZp686A17191
• Gene Symbols: SVIL
• Host Species: Mouse
• Immunogen: SVIL (NP_003165, 1679 a.a. ∽ 1786 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6840
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only