Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106708

TIMM13, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89106708 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-708 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-708 Supplier Abnova Corporation Supplier No. H00026517A01
Only null left
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length recombinant TIMM13.

This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. [provided by RefSeq

Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM

Specifications

Antigen TIMM13
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length recombinant TIMM13.
Formulation 50% glycerol
Gene TIMM13
Gene Accession No. BC008607
Gene Alias TIM13/TIM13B/TIMM13A/TIMM13B/ppv1
Gene Symbols TIMM13
Host Species Mouse
Immunogen TIMM13 (AAH08607, 1 a.a. ∽ 95 a.a) full-length recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26517
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.