TIMM13, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant TIMM13.

Supplier:  Abnova Corporation H00026517A01

Catalog No. 89-106-708

Description

This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. [provided by RefSeq

Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM

Specifications

• Antigen: TIMM13
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant TIMM13.
• Gene: TIMM13
• Gene Alias: TIM13/TIM13B/TIMM13A/TIMM13B/ppv1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC008607
• Gene Symbols: TIMM13
• Immunogen: TIMM13 (AAH08607, 1 a.a. ∽ 95 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 26517
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only