TMEM189-UBE2V1 (Kua-UEV), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant Kua-UEV.

Supplier:  Abnova Corporation H00387522A01

Catalog No. 89-107-786

Description

The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined. [provided by RefSeq

Sequence: VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ

Specifications

• Antigen: TMEM189-UBE2V1 (Kua-UEV)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant Kua-UEV.
• Gene: TMEM189-UBE2V1
• Gene Alias: CROC-1B/Kua-UEV/UBE2V1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_199203
• Gene Symbols: TMEM189-UBE2V1
• Immunogen: Kua-UEV (NP_954673, 94 a.a. ∽ 164 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 387522
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only