Abnova™ Mouse Ccl21a (P84444, 24 a.a. - 133 a.a.) Partial Recombinant Protein

Catalog No.	Quantity
89-938-389	20 μg

Catalog No. 89-938-389 Supplier Abnova™ Supplier No. P4353

Description

Used for Func, SDS-PAGE

Sequence: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Specifications

• Accession Number: P84444
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 18829
• Molecular Weight (g/mol): 12kDa
• Name: Ccl21a (Mouse) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 20 μg
• Immunogen: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
• Gene Alias: 6CKBAC2/6Ckine/ALP/AW987545/CKb9/MGC107632/SCYA21a/SLC/Scya21/Scya21b/Tca4/plt
• Common Name: Ccl21a
• Gene Symbol: Ccl21a
• Biological Activity: Determined by its ability to chemoattract total lymphocyte population using a concentration range of 10.0-100.0ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC