Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89941063

Abnova™ Mouse Cxcl16 (Q8BSU2, 88 amino acids) Partial Recombinant Protein

Catalog No. 89941063 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-941-063 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-941-063 Supplier Abnova™ Supplier No. P4500

Description

Used for SDS-PAGE

Sequence: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Specifications

Accession Number Q8BSU2
For Use With (Application) SDS-PAGE
Formulation Lyophilized from 20mM sodium phosphate, 50mM NaCl, pH 7.4
Gene ID (Entrez) 66102
Molecular Weight (g/mol) 9.9kDa
Name Mouse Cxcl16 (Q8BSU2, 88 amino acids) Partial Recombinant Protein
Quantity 25 μg
Storage Requirements Store at −20°C on dry atmosphere.After reconstitution with sterilized ddH2O, store at −20°C.Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias 0910001K24Rik, AV290116, BB024863, SR-PSOX, Zmynd15
Common Name CXCL16
Gene Symbol Cxcl16
Species E. coli
Recombinant Recombinant
Protein Tag Untagged
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade ≥97% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.