Abnova™ Mouse Fgf2 (P15655, 10 a.a. - 154 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P4350

Catalog No. 89-944-465

Description

Sequence: PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Specifications

• Accession Number: P15655
• Formulation: Lyophilized
• Molecular Weight (g/mol): 16kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 50 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
• Common Name: Fgf2
• Biological Activity: The ED50 was determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤ 0.2ng/mL, corresponding to a specific activity of ≥ 1 x 10⁶ units/mg.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 14173
• Name: Fgf2 (Mouse) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Immunogen: PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Regulatory Status: RUO
• Gene Alias: Fgf-2/Fgfb/bFGF
• Gene Symbol: Fgf2
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized