Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89944492

Abnova™ Mouse Fgf7 (P36363, 164 amino acids) Partial Recombinant Protein

Catalog No. 89944492 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-944-492 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-944-492 Supplier Abnova™ Supplier No. P4492

Description

Used for Func, SDS-PAGE

Sequence: MCNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Specifications

Accession Number P36363
For Use With (Application) Functional Assay, SDS-PAGE
Formulation Lyophilized from 20mM phosphate, 0.1M NaCl, pH 8.0
Gene ID (Entrez) 14178
Molecular Weight (g/mol) 18.9kDa
Name Mouse Fgf7 (P36363, 164 amino acids) Partial Recombinant Protein
Quantity 10 μg
Storage Requirements Store at −20°C on dry atmosphere.After reconstitution with sterilized ddH2O, store at −20°C.Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg
Gene Alias Kgf
Common Name FGF7
Gene Symbol Fgf7
Biological Activity The ED50 calculated by the dose-dependant stimulation of KGF-responsive BaF3 indicator cells (measured by 3H-thymidine uptake) is < 10ng/mL corresponding to a specific activity of 100,000 units/mg.
Species E. coli
Recombinant Recombinant
Protein Tag Untagged
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade ≥95% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.