Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Ifng (P01580) Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P4596

Catalog No. 89-948-399


Add to cart

Description

Description

Sequence: MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Specifications

Specifications

P01580
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
15.6kDa
Escherichia coli expression system
MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
RUO
IFN-g|IFN-gamma|Ifg
Ifng
Escherichia coli
None
Escherichia coli expression system
Lyophilized
15978
Ifng (Mouse) Recombinant Protein
100 ug
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1 EU/μg
Ifng
The activity is determined by a viral challenge assay using EMC virus on L929 cells, is 1.1-1.3 x 107 Units/mg. The expected ED50 for this effect is 0.04-0.09ng/mL.
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit