Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89948696

Abnova™ Mouse Il17f (Q7TN17) Recombinant Protein

Catalog No. 89948696 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-948-696 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-948-696 Supplier Abnova™ Supplier No. P4625
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

Sequence: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Specifications

Accession Number Q7TN17
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 257630
Molecular Weight (g/mol) 30kDa
Name Il17f (Mouse) Recombinant Protein
Preparation Method Escherichia coli expression system
Quantity 25 μg
Immunogen MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Storage Requirements Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1 EU/μg
Gene Alias C87042/IL-17F
Common Name Il17f
Gene Symbol Il17f
Biological Activity The activity is determined by the dose-dependant induction of IL-6 in NIH 3T3 cells and is typically 35-50ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.