Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Il4 (P07750, 21 a.a. - 140 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P4363

Catalog No. 89-948-913


Add to cart

Description

Description

Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Specifications

Specifications

P07750
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
14kDa
Escherichia coli expression system
>90% by SDS-PAGE and HPLC
HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
RUO
Il-4
Il4
Escherichia coli
None
Escherichia coli expression system
Lyophilized
16189
Il4 (Mouse) Recombinant Protein
Ion exchange column and HPLC reverse phase column
10 ug
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
Il4
The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is < 0.4ng/mL, corresponding to a specific activity of > 2 x 106 units/mg.
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit