Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Mouse Il7 (P10168) Recombinant Protein
Used for Func, SDS-PAGE
Supplier: Abnova™ P4583
Description
Sequence: MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSISpecifications
P10168 | |
Lyophilized | |
17.4kDa | |
Escherichia coli expression system | |
MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI | |
RUO | |
A630026I06Rik/Il-7/MGC129342/hlb368 | |
Il7 | |
E. coli | |
None | |
Lyophilized |
Functional Study, SDS-PAGE | |
16196 | |
Il7 (Mouse) Recombinant Protein | |
10 ug | |
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
<0.1 EU/μg | |
Il7 | |
The activity is determined by dose-dependent induction of 2E8 cell proliferation and is typically less than 0.2ng/mL. | |
Recombinant | |
Escherichia coli expression system |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction