Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ MYPT1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579857
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579857 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579857 Supplier Invitrogen™ Supplier No. PA579857
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HELA whole cell, human Jurkat whole cell, human HEK293 whole cell, monkey COS-7 whole cell, human Raji whole cell, human K562 whole cell, human CACO-2 whole cell, human HEPG2 whole cell, rat brain tissue, rat lung tissue, rat liver tissue, rat C6 whole cell, mouse brain tissue, mouse lung tissue, mouse liver tissue, mouse NIH/3T3 whole cell. IHC: Human Glioma tissue. ICC/IF: SiHa cell, U251 cell, U251 cell, U251 cell, U251 cell. Flow: Hela cell, SiHa cell, U251 cell.

Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP. RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MYPT1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene PPP1R12A
Gene Accession No. O14974, Q10728, Q9DBR7
Gene Alias 1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
Gene Symbols PPP1R12A
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 116670, 17931, 4659
Target Species Human, Mouse, Rat, Monkey
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.