Novus Biologicals™ NALP6 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP6. The NALP6 Recombinant Protein Antigen is derived from E. coli. The NALP6 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-47362. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 171389
• Species: Human
• Purification Method: Chromatography
• Purity: >80%
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: Angiotensin II/Vasopressin Receptor, AVR, CLR11.4, NACHT, Leucine Rich Repeat And PYD Containing 6, NACHT, LRR And PYD Containing Protein 6, NACHT, LRR And PYD Domains-Containing Protein 6, NAVR, NAVR/AVR, NLR Family, Pyrin Domain Containing 6, NLRP6 Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 6, PAN3, PYPAF5, PYRIN-Containing APAF1-Like Protein 5
• Gene Symbol: NLRP6
• Label Type: Unlabeled
• Molecular Weight (g/mol): 30kDa
• Product Type: NALP6
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47362. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Immunogen: GEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSSQGTTKQLPASLLHPLFQ

For Research Use Only