Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Life Sciences
  4. Protein Biology
  5. Proteins
  6. Proteins A-Z
  7. Proteins N
  8. NBP257444PE

Novus Biologicals™ NAT8 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP257444PEP

Catalog No. NBP257444PE


Add to cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAT8. Source: E.coli Amino Acid Sequence: DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV The NAT8 Recombinant Protein Antigen is derived from E. coli. The NAT8 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Blocking/Neutralizing, Control
9027
>80% by SDS-PAGE and Coomassie blue staining
E.coli
RUO
NAT8
Unlabeled
Yes
PBS and 1M Urea, pH 7.4.
NAT8 Recombinant Protein Antigen
100μL
Store at −20°C. Avoid freeze-thaw cycles.
Camello-like protein 1, CML1, EC 2.3.1, EC 2.3.1.-, GLAkidney- and liver-specific gene product, Hcml1, N-acetyltransferase 8, N-acetyltransferase 8 (GCN5-related, putative), probable N-acetyltransferase 8, TSC501N-acetyltransferase 8 (camello like), TSC51
Recombinant Protein Antigen
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only.