Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ NDUFB10 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257790PEP

Catalog No. NBP257790PE



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFB10. Source: E.coli Amino Acid Sequence: IVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAK The NDUFB10 Recombinant Protein Antigen is derived from E. coli. The NDUFB10 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


NDUFB10 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4
CI-PDSW, complex I PDSW subunit, Complex I-PDSW, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10, NADH ubiquinon
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles
Blocking/Neutralizing, Control
Recombinant Protein Antigen
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50909. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions



Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For research use only.