Novus Biologicals™ NEDD4L Recombinant Protein Antigen

Catalog No.	Quantity
NBP256344PE	100μL

Catalog No. NBP256344PE Supplier Novus Biologicals™ Supplier No. NBP256344PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEDD4L. Source: E.coli Amino Acid Sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP The NEDD4L Recombinant Protein Antigen is derived from E. coli. The NEDD4L Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 23327
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: NEDD4L Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: E3 ubiquitin-protein ligase NEDD4-like, EC 6.3.2, EC 6.3.2.-, FLJ33870, hNedd4-2, KIAA0439ubiquitin-protein ligase NEDD4-like, NEDD4.2, Nedd4-2, NEDL3, neural precursor cell expressed, developmentally down-regulated 4-like, neural precursor cell expressed
• Gene Symbol: NEDD4L
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50643. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.