CPC Scientific H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp-OH (trifluoroacetate salt) 1MG

Supplier:  CPC Scientific NEUP014B

This peptide was recently identified as the endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8 which are expressed in the central nervous system. NPW-30 activated and bound to both GPR7 and GPR8 at similar effective doses. Intracerebroventricular administration of NPW in rats resulted in an increased food intake and stimulation of prolactin release indicating that NPW acts as a mediator of the central control of feeding and the neuroendocrine system. ONE-LETTER SEQUENCE: WYKHVASPRYHTVGRAAGLLMGLRRSPYLWMOLECULAR FORMULA: C165H249N49O37S1MOLECULAR WEIGHT:3543.17STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [383415-80-3], RESEARCH AREA: NeuropeptidesREFERENCES: Y.Shimomura et al., J. Biol. Chem., 277, 35826 (2002); S.Brezillon et al., J. Biol. Chem., 278, 776 (2003); H.Tanaka et al., Proc. Natl. Acad. Sci. USA, 100, 6251 (2003);

Catalog No. 50-210-9907