Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118365

Novus Biologicals™ Recombinant E. coli Disulfide oxidoreductase Protein
SDP

Catalog No. NBC118365
missing translation for 'orderingAttributeHoverText'
:
0.1mg; Unlabeled

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 20-208 of E.coli Disulfide oxidoreductase The Recombinant E. coli Disulfide oxidoreductase Protein is derived from E. coli. The Recombinant E. coli Disulfide oxidoreductase Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris buffer (pH 7.5), 2mM EDTA
Gene ID (Entrez) 948353
Molecular Weight (g/mol) 21.1kDa
Name Disulfide oxidoreductase Protein
Purification Method Protein
Immunogen AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Bacteria
Purity or Quality Grade >95%, by SDS-PAGE
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.