Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant E. coli Disulfide oxidoreductase Protein
SDP

Catalog No. NBC118365 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118365 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118365 Supplier Novus Biologicals™ Supplier No. NBC118365
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 20-208 of E.coli Disulfide oxidoreductase The Recombinant E. coli Disulfide oxidoreductase Protein is derived from E. coli. The Recombinant E. coli Disulfide oxidoreductase Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris buffer (pH 7.5), 2mM EDTA
Gene ID (Entrez) 948353
Molecular Weight (g/mol) 21.1kDa
Name Disulfide oxidoreductase Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Bacteria
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.