Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118429

Novus Biologicals™ Recombinant E. coli Ferric uptake regulator Protein
SDP

Catalog No. NBC118429 Shop All R&D Systems Products
Click to view available options
Quantity:
0.1 mg

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-148 of E.coli Ferric uptake regulator The Recombinant E. coli Ferric uptake regulator Protein is derived from E. coli. The Recombinant E. coli Ferric uptake regulator Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 2 mM CaCl2, 100 mM NaCl
Molecular Weight (g/mol) M.W. (theoretical): 16.7 kDa
Name Ferric uptake regulator Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Gene Symbol fur
Cross Reactivity Bacteria
Research Category Cell Cycle and Replication
Purity or Quality Grade >95%, by SDS-PAGE
Protein Ferric uptake regulator
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.