Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant E. coli GrpE Protein
SDP

Catalog No. NBC118370 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118370 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118370 Supplier Novus Biologicals™ Supplier No. NBC118370
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

An un-tagged recombinant protein corresponding to the amino acids 1-197 of E.coli GrpE The Recombinant E. coli GrpE Protein is derived from E. coli. The Recombinant E. coli GrpE Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 100 mM NaCl
Gene ID (Entrez) 947097
Molecular Weight (g/mol) M.W. (theoretical): 21.8 kDa
Name GrpE Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Gene Symbol grpE
Cross Reactivity Bacteria
Purity or Quality Grade >90%, by SDS-PAGE
Protein GrpE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.