Learn More
Description
Specifications
Specifications
| Concentration | 1 mg/mL |
| For Use With (Application) | SDS-PAGE |
| Formulation | 20 mM Tris-HCl buffer (pH 8.0), 100 mM NaCl |
| Gene ID (Entrez) | 947097 |
| Molecular Weight (g/mol) | M.W. (theoretical): 21.8 kDa |
| Name | GrpE Protein |
| Purification Method | Protein |
| Quantity | 0.1 mg |
| Immunogen | MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA |
| Storage Requirements | Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.) |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
