Novus Biologicals™ Recombinant E. coli GrpE Protein

Description

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

An un-tagged recombinant protein corresponding to the amino acids 1-197 of E.coli GrpE The Recombinant E. coli GrpE Protein is derived from E. coli. The Recombinant E. coli GrpE Protein has been validated for the following applications: SDS-Page.

Specifications

• Concentration: 1 mg/mL
• For Use With (Application): SDS-PAGE
• Formulation: 20 mM Tris-HCl buffer (pH 8.0), 100 mM NaCl
• Gene ID (Entrez): 947097
• Molecular Weight (g/mol): M.W. (theoretical): 21.8 kDa
• Name: GrpE Protein
• Purification Method: Protein
• Quantity: 0.1 mg
• Immunogen: MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA
• Storage Requirements: Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
• Gene Symbol: grpE
• Cross Reactivity: Bacteria
• Purity or Quality Grade: >90%, by SDS-PAGE
• Protein: GrpE