Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ EIF1AX Protein

Highly purified. Generating reliable and reproducible results.

Manufacturer:  Novus Biologicals™ NBP1483910.5MG

 View more versions of this product

Catalog No. NBP1483915


Add to cart

Description

Description

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-144 of Human EIF1AX The Recombinant Human EIF1AX Protein is derived from E. coli. The Recombinant Human EIF1AX Protein has been validated for the following applications: SDS-Page.
Specifications

Specifications

1mg/mL
Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 40% glycerol, 5mM DTT, 200mM NaCl
18.6kDa
>90%
Human
Store at -80°C. Avoid freeze-thaw cycles.
EIF1AX
ELISA, SDS-Page
1964
Protein
0.5mg
MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
RUO
Unlabeled
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit