Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118481

Novus Biologicals™ Recombinant Human BAFF/BLyS/TNFSF13B His Protein
SDP

Catalog No. NBC118481 Shop All R&D Systems Products
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBC118481 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118481 Supplier Novus Biologicals™ Supplier No. NBC118481
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-terminal His-tag corresponding to amino acids 134 - 285 of TNFSF13B. The Recombinant Human BAFF/BLyS/TNFSF13B Protein is derived from E. coli. The Recombinant Human BAFF/BLyS/TNFSF13B Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_006564
For Use With (Application) Western Blot
Formulation 20mM Tris buffer (pH 8.0), 5mM DTT
Gene ID (Entrez) 10673
Name BAFF/BLyS/TNFSF13B protein
Purification Method Protein
Immunogen MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.