Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human GADD153/CHOP His Protein
SDP

Catalog No. NBC118430 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118430 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118430 Supplier Novus Biologicals™ Supplier No. NBC118430
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids1-169 of Human GADD153/CHOP The Recombinant Human GADD153/CHOP Protein is derived from E. coli. The Recombinant Human GADD153/CHOP Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_004074
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 20% Glycerol
Gene ID (Entrez) 1649
Molecular Weight (g/mol) M.W. (theoretical): 21.3 kDa
Name GADD153/CHOP Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Gene Symbol DDIT3
Cross Reactivity Human
Research Category Cell Cycle and Replication, DNA Repair, Hypoxia, Unfolded Protein Response
Purity or Quality Grade >90%, by SDS-PAGE
Protein GADD153/CHOP
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.