Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Recombinant Human IRF2 His Protein

Click to view available options
Quantity:
0.1 mg
Description
A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-113 of Human IRF2 The Recombinant Human IRF2 Protein is derived from E. coli. The Recombinant Human IRF2 Protein has been validated for the following applications: SDS-Page.
Specifications
Specifications
Accession Number | NM_002190 |
Concentration | 1 mg/mL |
For Use With (Application) | SDS-PAGE |
Formulation | 20 mM Tris buffer (pH 8.0), 10% glycerol, 1 mM DTT |
Gene ID (Entrez) | 3660 |
Molecular Weight (g/mol) | M.W. (theoretical): 15 kDa |
Name | IRF2 Protein |
Purification Method | Protein |
Quantity | 0.1 mg |
Immunogen | MGSSHHHHHHSSGLVPRGSHMPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLP |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction