Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118476

Novus Biologicals™ Recombinant Human IRF2 His Protein
SDP

Catalog No. NBC118476
Click to view available options
Quantity:
0.1 mg

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-113 of Human IRF2 The Recombinant Human IRF2 Protein is derived from E. coli. The Recombinant Human IRF2 Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NM_002190
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris buffer (pH 8.0), 10% glycerol, 1 mM DTT
Gene ID (Entrez) 3660
Molecular Weight (g/mol) M.W. (theoretical): 15 kDa
Name IRF2 Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLP
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Endotoxin Concentration <1.0 EU / 1 μg of protein (determined by LAL method)
Gene Symbol IRF2
Cross Reactivity Human
Research Category Cytokine Research
Purity or Quality Grade >95%, by SDS-PAGE
Protein IRF2
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.