Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118536

Novus Biologicals™ Recombinant Human Myosin Light Chain 2 His Protein
SDP

Catalog No. NBC118536 Shop All R&D Systems Products
Change view
Click to view available options
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBC118536 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118536 Supplier Novus Biologicals™ Supplier No. NBC118536
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids1-166 of Human Myosin Light Chain 2 The Recombinant Human Myosin Light Chain 2 Protein is derived from E. coli. The Recombinant Human Myosin Light Chain 2 Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_000423
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 8.0), 40% glycerol, 5mM CaCl2
Gene ID (Entrez) 4633
Molecular Weight (g/mol) 20.9kDa
Name Myosin Light Chain 2 Protein
Purification Method Protein
Immunogen MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Endotoxin Concentration <1 EU per 1ug of protein (determined by LAL method)
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.