Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118379

Novus Biologicals™ Recombinant Human PPIL1 His Protein
SDP

Catalog No. NBC118379 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118379 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118379 Supplier Novus Biologicals™ Supplier No. NBC118379
Only null left
Add to Cart
Add to Cart

Description

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Specific activity is > 700 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAPF-pNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin.

Specifications

Accession Number NP_057143
For Use With (Application) Bioactivity, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 8.0), 20% glycerol
Gene ID (Entrez) 51645
Molecular Weight (g/mol) 19.3kDa
Name PPIL1 Protein
Purification Method Protein
Quantity 0.1 mg
Source E. Coli
Immunogen 1-166aa, MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSGLEHHHHHH
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.