Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human VAMP-1 His Protein
SDP

Catalog No. NBC118336 Shop All R&D Systems Products
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBC118336 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118336 Supplier Novus Biologicals™ Supplier No. NBC118336
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-91 of Human VAMP-1 The Recombinant Human VAMP-1 Protein is derived from E. coli. The Recombinant Human VAMP-1 Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_055046
For Use With (Application) ELISA, SDS-PAGE
Formulation PBS (pH 7.4), 1mM EDTA
Gene ID (Entrez) 6843
Molecular Weight (g/mol) 11.9kDa
Name VAMP-1 Protein
Purification Method Protein
Immunogen MGSSHHHHHHSSGLVPRGSHMSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYW
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.