Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110067

CPC Scientific H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific PACA008B

Encompass

This peptide is the fragment 6-38 of PACAP, which is a much more potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase than PACAP (6-27). Ki values for the inhibition of the enzyme were 7 nM and 150 nM respectively.ONE-LETTER SEQUENCE: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2MOLECULAR FORMULA: C182H300N56O45S1MOLECULAR WEIGHT:4024.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [143748-18-9], SYNONYMS: Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)RESEARCH AREA: HormonalREFERENCES: P. Robberecht et al., Mol. Pharmacol., 42, 347 (1992); P. Robberecht et al., Eur. J. Biochem., 207, 239 (1992); F. Ohno et al., Regul. Peptides, 126, 115 (2005); P. Robberecht, P. Gourlet, P. De Neef, M-C. Woussen-Colle, M-C. Vandermeers-Piret,A. Vandermeers, and J. Christophe, Eur. J. Biochem., 207, 239 (1992) (Original); A. Vandermeers, S. Vandenborre, X. Hou, P. De Neef, P. Robberecht, M-C. Vandermeers-Piret,an

Catalog No. 50-211-0067


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.