Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 (trifluoroacetate salt) 1MG
Supplier: CPC Scientific PACA008B
This peptide is the fragment 6-38 of PACAP, which is a much more potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase than PACAP (6-27). Ki values for the inhibition of the enzyme were 7 nM and 150 nM respectively.ONE-LETTER SEQUENCE: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2MOLECULAR FORMULA: C182H300N56O45S1MOLECULAR WEIGHT:4024.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [143748-18-9], SYNONYMS: Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)RESEARCH AREA: HormonalREFERENCES: P. Robberecht et al., Mol. Pharmacol., 42, 347 (1992); P. Robberecht et al., Eur. J. Biochem., 207, 239 (1992); F. Ohno et al., Regul. Peptides, 126, 115 (2005); P. Robberecht, P. Gourlet, P. De Neef, M-C. Woussen-Colle, M-C. Vandermeers-Piret,A. Vandermeers, and J. Christophe, Eur. J. Biochem., 207, 239 (1992) (Original); A. Vandermeers, S. Vandenborre, X. Hou, P. De Neef, P. Robberecht, M-C. Vandermeers-Piret,an
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction