Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110055

CPC Scientific H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 1MG
SDP

Supplier:  CPC Scientific PACA002B

Encompass

SEQUENCE: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2ONE-LETTER SEQUENCE: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2MOLECULAR FORMULA: C203H331N63O53S1MOLECULAR WEIGHT: 4534.32STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [124123-15-5]SYNONYMS: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP-38 (human, mouse, ovine, porcine, rat)RESEARCH AREA: HormonalREFERENCES:A. Miyata et al., BBRC, 164, 567 (1989)K. Ogi et al., BBRC, 173, 1271 (1990)SKU(s): PACA-002A, PACA-002B

Catalog No. 50-211-0055


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.