Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580084

Invitrogen™ PC4 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580084
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580084 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580084 Supplier Invitrogen™ Supplier No. PA580084
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, human MCF-7 whole cell, human T47D whole cell, human PC-3 whole cell, human Jurkat whole cell, human placenta tissue, human HL-60 whole cell, rat liver tissue, rat spleen tissue, rat stomach tissue, rat RH35 whole cell, mouse liver tissue, mosue spleen tissue. IHC: human esophageal squamous carcinoma tissue, human endometrioid adenocarcinoma type I tissue.

PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PC4
Applications Immunohistochemistry (Paraffin), Western Blot, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene Sub1
Gene Accession No. P11031, P53999, Q63396
Gene Alias activated RNA polymerase II transcription cofactor 4; activated RNA polymerase II transcriptional coactivator p15; AI842364; hypothetical protein LOC553561; p14; P15; P9; Pc4; positive cofactor 4; pR-ET2 encoded oncodevelopmental protein; RNA polymerase II transcriptional coactivator; Rpo2tc1; Single-stranded DNA-binding protein p9; Sub1; SUB1 homolog; SUB1 homolog (S. cerevisiae); SUB1 homolog a; SUB1 homolog, transcriptional regulator; SUB1 homolog, transcriptional regulator a; SUB1 regulator of transcription; SUB1 regulator of transcription a; sub1a; TIS7; zgc:109973
Gene Symbols Sub1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10923, 192269, 20024
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.