Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ PCDH15 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595603 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595603 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595603 Supplier Invitrogen™ Supplier No. PA595603
Add to Cart
Edge
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human U2OS whole cell, human Hela whole cell, rat brain tissue, rat lung tissue, mouse brain tissue, mouse lung tissue, mouse kidney tissue, mouse spleen tissue, mouse Neuro-2a whole cell. IHC: human skeletal muscle tissue, human prostatic cancer tissue, human rectal cancer tissue, human tonsil tissue, mouse brain tissue, mouse spleen tissue, rat brain tissue, rat spleen tissue. Flow: U-87MG cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PCDH15
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene PCDH15
Gene Accession No. Q96QU1, Q99PJ1
Gene Alias Ames waltzer; av; BB078305; cadherin-related family member 15; CDHR15; DFNB23; DKFZp667A1711; ENSMUSG00000046980; Gm9815; nmf19; Pcdh15; protocadherin 15; protocadherin 15 CD2; protocadherin 15 CD3 isoform; protocadherin related 15; protocadherin-15; protocadherin-15-CD2; protocadherin-related 15; RP11-449J3.2; USH1F
Gene Symbols PCDH15
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11994, 65217, 690865
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.