Invitrogen™ PDGF-B Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595438

Catalog No. PIPA595438

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.

Specifications

• Antigen: PDGF-B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PDGFB
• Gene Alias: becaplermin; c-sis; I79_017626; IBGC5; PDGF; pdgf protein; PDGF subunit B; PDGF, B chain; PDGF2; PDGF-2; Pdgfb; PDGF-B; platelet derived growth factor subunit B; platelet derived growth factor, B polypeptide; platelet-derived growth factor 2; platelet-derived growth factor B; platelet-derived growth factor B chain; platelet-derived growth factor B subunit; platelet-derived growth factor beta; platelet-derived growth factor beta isoform 1, preproprotein; platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); Platelet-derived growth factor subunit B; platelet-derived growth factor, beta polypeptide (oncogene SIS); Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); proto-oncogene c-Sis; Sis; SSV; v-sis platelet-derived growth factor beta polypeptide (simian sarcoma viral oncogene homolog)
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 18591, 24628, 5155
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P01127, P31240, Q05028
• Gene Symbols: PDGFB
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG