Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP256901PE

Novus Biologicals™ PJA2/Praja2 Recombinant Protein Antigen
SDP

Catalog No. NBP256901PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP256901PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP256901PE Supplier Novus Biologicals™ Supplier No. NBP256901PEP
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PJA2/Praja2. Source: E.coli Amino Acid Sequence: DEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRW The PJA2/Praja2 Recombinant Protein Antigen is derived from E. coli. The PJA2/Praja2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 9867
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name PJA2/Praja2 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias E3 ubiquitin-protein ligase Praja-2, EC 6.3.2, EC 6.3.2.-, KIAA0438praja2, Neurodap1, praja ring finger 2, Praja2, RING finger protein 131praja 2, RING-H2 motif containing, RNF131
Gene Symbol PJA2
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50370. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.