Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ PKC gamma Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595607

Catalog No. PIPA595607


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human U87 whole cell, rat brain tissue, mouse brain tissue, rat kidney tissue, mouse kidney tissue. IHC: human glioma tissue, mouse brain tissue, mouse brain tissue, rat brain tissue, mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat celebellum tissue. ICC/IF: SH-SY5Y cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The PKC family of serine/threonine kinases, including PRKCG (PKC gamma), is activated intracellularly by signal transduction pathways. In humans, at least 12 different PKC polypeptides have been identified. These isoforms differ in primary structure, tissue distribution, subcellular localization, mode of action in vitro, response to extracellular signals, and substrate specificity. PKC alpha, beta I, beta II, and gamma form the conventional family; their activities are Ca2+- and phospholipid-dependent. Protein kinase C can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. PKC gamma is one of the PKC family members. This protein kinase is expressed solely in the brain and spinal cord and its localization is restricted to neurons. It has been demonstrated that several neuronal functions, including long term potentiation (LTP) and long term depression (LTD), specifically require this kinase. Knockout studies in mice also suggest that this kinase may be involved in neuropathic pain development. Defects in this protein have been associated with neurodegenerative disorder spinocerebellar ataxia-14 (SCA14).
TRUSTED_SUSTAINABILITY
Specifications

Specifications

PKC gamma
Polyclonal
Unconjugated
PRKCG
PKC; Pkcc; PKCG; PKCgamma; PKC-gamma; PKCI; Prkc; Prkcc; PRKCG; protein kinase C gamma; protein kinase C gamma type; protein kinase C type I (gamma type); protein kinase C, gamma; RATPKCI; SCA14
Rabbit
Affinity Chromatography
RUO
18752, 24681, 5582
-20°C
Lyophilized
Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
500 μg/mL
PBS with 4mg trehalose and 0.05mg sodium azide
P05129, P63318, P63319
PRKCG
A synthetic peptide corresponding to a sequence of human PKC gamma/PRKCG (DRLVLASIDQADFQGFTYVNPDFVHPDARS).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.