Novus Biologicals™ SLC25A17 Recombinant Protein Antigen

Catalog No.	Quantity
NBP230684PE	0.1 mL

Catalog No. NBP230684PE Supplier Novus Biologicals™ Supplier No. NBP230684PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC25A17. The SLC25A17 Recombinant Protein Antigen is derived from E. coli. The SLC25A17 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-30684. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 10478
• Species: Human
• Purification Method: Chromatography
• Purity: >80%
• Common Name: SLC25A17
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: 34 kDa peroxisomal membrane protein, peroxisomal membrane protein (34kD), peroxisomal membrane protein PMP34, PMP34, Solute Carrier Family 25 (Mitochondrial Carrier; Peroxisomal Membrane Protein, 34kD), Member 17, Solute Carrier Family 25 Member 17
• Gene Symbol: SLC25A17
• Label Type: Unlabeled
• Molecular Weight (g/mol): 22kDa
• Product Type: PMP34
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30684. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Immunogen: TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR

For Research Use Only