Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108630

CPC Scientific H-Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific ADRM008B

Encompass

The adrenomedullin (ADM) precursor fragment is used in diagnosing several disease states, such as the dysfunction of the cardiovascular system and sepsis. The released amounts of these peptides is a reflection of the stoichiometric generation of ADM and proADM. ADM cannot be easily determined directly, because of the masking by binding proteins, instability in serum and stickiness to surfaces. ONE-LETTER SEQUENCE: ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVMOLECULAR FORMULA: C215H359N67O73S2MOLECULAR WEIGHT:5114.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [166798-69-2], RESEARCH AREA: CardiovascularREFERENCES: J.Struck et al., Peptides , 25, 1369 (2004)

Catalog No. 50-210-8630


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.