Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579891

Invitrogen™ PSMA4 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579891
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579891 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579891 Supplier Invitrogen™ Supplier No. PA579891
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse spleen tissue, HELA whole cell.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PSMA4
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Psma4
Gene Accession No. P21670, P25789, Q9R1P0
Gene Alias C9; HC9; HsT17706; LOW QUALITY PROTEIN: proteasome subunit alpha type-4; macropain subunit C9; MGC111191; MGC12467; MGC24813; Multicatalytic endopeptidase complex subunit C9; multicatalytic proteinase subunit L; proteasome (prosome, macropain) subunit, alpha type 4; proteasome (prosome, macropain) subunit, alpha type, 4; proteasome 20S subunit alpha 4; proteasome alpha 4 subunit; proteasome component C9; proteasome subunit alpha 4; proteasome subunit alpha type-4; proteasome subunit alpha type-4-like protein; proteasome subunit HC9; proteasome subunit L; PSC9; PSMA 4; PSMA4; QtsA-10816; unnamed protein product; wu:fe05d10; zgc:56176
Gene Symbols Psma4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26441, 29671, 5685
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.