Invitrogen™ PSMA4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579891

Catalog No. PIPA579891

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse spleen tissue, HELA whole cell.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: PSMA4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Psma4
• Gene Alias: C9; HC9; HsT17706; LOW QUALITY PROTEIN: proteasome subunit alpha type-4; macropain subunit C9; MGC111191; MGC12467; MGC24813; Multicatalytic endopeptidase complex subunit C9; multicatalytic proteinase subunit L; proteasome (prosome, macropain) subunit, alpha type 4; proteasome (prosome, macropain) subunit, alpha type, 4; proteasome 20S subunit alpha 4; proteasome alpha 4 subunit; proteasome component C9; proteasome subunit alpha 4; proteasome subunit alpha type-4; proteasome subunit alpha type-4-like protein; proteasome subunit HC9; proteasome subunit L; PSC9; PSMA 4; PSMA4; QtsA-10816; unnamed protein product; wu:fe05d10; zgc:56176
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 26441, 29671, 5685
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P21670, P25789, Q9R1P0
• Gene Symbols: Psma4
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG