Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ PTPRK Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258338PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRK. Source: E.coli Amino Acid Sequence: QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM The PTPRK Recombinant Protein Antigen is derived from E. coli. The PTPRK Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 5796 | |
| PTPRK Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| DKFZp686C2268, DKFZp779N1045, EC 3.1.3.48, protein tyrosine phosphatase kappa protein tyrosine phosphatase kappa, protein tyrosine phosphatase, receptor type, K, Protein-tyrosine phosphatase kappa, protein-tyrosine phosphatase, receptor type, kappa, PTPK, receptor type, K (R-PTP-KAPPA, receptor-type tyrosine-protein phosphatase kappa | |
| Unlabeled | |
| 100μL | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| PTPRK | |
| Recombinant Protein Antigen | |
| RUO | |
| Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only