Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89953477

Abnova™ Purified CD274 (AAH74984.1, 18 a.a. - 238 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells (H02)

Catalog No. 89953477 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-953-477 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-953-477 Supplier Abnova™ Supplier No. H00029126H02
Add to Cart
Add to Cart

Description

Used for ELISA, PI, SDS-PAGE, WB

Sequence: AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Specifications

Accession Number AAH74984.1
Concentration ≥ 10 ug/ml
For Use With (Application) ELISA, Protein Interaction, SDS-PAGE, Western Blot
Formulation Liquid
Gene ID (Entrez) 29126
Molecular Weight (g/mol) 29.59kDa
Name CD274 (Human) Recombinant Protein
Preparation Method Transfection of pSuper-CD274 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification Method Strep-Tactin affinity columns
Quality Control Testing SDS-PAGE and Western Blot
Quantity 25 μg
Immunogen AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias B7-H/B7H1/MGC142294/MGC142296/PD-L1/PDCD1L1/PDCD1LG1/PDL1
Common Name CD274
Gene Symbol CD274
Biological Activity Not Tested
Species Human
Recombinant Recombinant
Protein Tag His-Flag-StrepII
Expression System Transfection of pSuper-CD274 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.