Abnova™ Purified HMGB2 (NP_002120.1, 1 a.a. - 209 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells

Catalog No.	Quantity
89-953-483	2 μg

Catalog No. 89-953-483 Supplier Abnova™ Supplier No. H00003148H01

Description

Used for ELISA, PI, SDS-PAGE, WB

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq]

Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Specifications

• Accession Number: NP_002120.1
• Concentration: ≥ 10 ug/ml
• For Use With (Application): ELISA, Protein Interaction, SDS-PAGE, Western Blot
• Formulation: Liquid
• Gene ID (Entrez): 3148
• Molecular Weight (g/mol): 29.28kDa
• Name: HMGB2 (Human) Recombinant Protein
• Preparation Method: Transfection of pSuper-HMGB2 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
• Purification Method: Strep-Tactin affinity columns
• Quality Control Testing: SDS-PAGE and Western Blot
• Quantity: 2 μg
• Immunogen: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: HMG2
• Common Name: HMGB2
• Gene Symbol: HMGB2
• Biological Activity: Not Tested
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-Flag-StrepII
• Expression System: Transfection of pSuper-HMGB2 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
• Form: Liquid