Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Purified NCR3 (NP_667341.1 19 a.a. - 135 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells

Catalog No. 89953488 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-953-488 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-953-488 Supplier Abnova™ Supplier No. H00259197H01
Add to Cart
Add to Cart

Used for ELISA, PI, SDS-PAGE, WB

Natural cytotoxicity receptors (NCRs), such as NCR3, are activating natural killer (NK) cell receptors that belong to the immunoglobulin (Ig) superfamily. NCR3 is expressed in all resting and activated NK cells and forms a complex with CD3-zeta (CD3Z, or CD247; MIM 186780) (Sato et al., 2001 [PubMed 11782277]).[supplied by OMIM]

Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

Specifications

Accession Number NP_667341.1
Concentration ≥ 10 ug/ml
For Use With (Application) ELISA, Protein Interaction, SDS-PAGE, Western Blot
Formulation Liquid
Gene ID (Entrez) 259197
Molecular Weight (g/mol) 18.15kDa
Name NCR3 (Human) Recombinant Protein
Preparation Method Transfection of pSuper-NCR3 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification Method Strep-Tactin affinity columns
Quality Control Testing SDS-PAGE and Western Blot
Quantity 25 μg
Immunogen LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias 1C7/CD337/LY117/MALS/NKp30
Common Name NCR3
Gene Symbol NCR3
Biological Activity Not Tested
Species Human
Recombinant Recombinant
Protein Tag His-Flag-StrepII
Expression System Transfection of pSuper-NCR3 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.