Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89953496

Abnova™ Purified TNFRSF10B (AAH01281.1, 56 a.a. - 210 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells

Catalog No. 89953496 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-953-496 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-953-496 Supplier Abnova™ Supplier No. H00008795H01
Add to Cart
Add to Cart

Description

Used for ELISA, PI, SDS-PAGE, WB

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq]

Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEAPAVEETVTSSPGTPASPCS

Specifications

Accession Number AAH01281.1
Concentration ≥ 10 ug/ml
For Use With (Application) ELISA, Protein Interaction, SDS-PAGE, Western Blot
Formulation Liquid
Gene ID (Entrez) 8795
Molecular Weight (g/mol) 22.33kDa
Name TNFRSF10B (Human) Recombinant Protein
Preparation Method Transfection of pSuper-TNFRSF10B plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification Method Strep-Tactin affinity columns
Quality Control Testing SDS-PAGE and Western Blot
Quantity 25 μg
Immunogen ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEAPAVEETVTSSPGTPASPCS
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CD262/DR5/KILLER/KILLER/DR5/TRAIL-R2/TRAILR2/TRICK2/TRICK2A/TRICK2B/TRICKB/ZTNFR9
Common Name TNFRSF10B
Gene Symbol TNFRSF10B
Biological Activity Not Tested
Species Human
Recombinant Recombinant
Protein Tag His-Flag-StrepII
Expression System Transfection of pSuper-TNFRSF10B plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.