Abnova™ Purified TNFRSF1A (AAH10140.1 22 a.a. - 211 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells (H02)

Catalog No.	Quantity
89-953-503	2 μg

Catalog No. 89-953-503 Supplier Abnova™ Supplier No. H00007132H02

Description

Used for ELISA, PI, SDS-PAGE, WB

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq]

Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Specifications

• Accession Number: AAH10140.1
• Concentration: ≥ 10 ug/ml
• For Use With (Application): ELISA, Protein Interaction, SDS-PAGE, Western Blot
• Formulation: Liquid
• Gene ID (Entrez): 7132
• Molecular Weight (g/mol): 26.18kDa
• Name: TNFRSF1A (Human) Recombinant Protein
• Preparation Method: Transfection of pSuper-TNFRSF1A plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
• Purification Method: Strep-Tactin affinity columns
• Quality Control Testing: SDS-PAGE and Western Blot
• Quantity: 2 μg
• Immunogen: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CD120a/FPF/MGC19588/TBP1/TNF-R/TNF-R-I/TNF-R55/TNFAR/TNFR1/TNFR55/TNFR60/p55/p55-R/p60
• Common Name: TNFRSF1A
• Gene Symbol: TNFRSF1A
• Biological Activity: Not Tested
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-Flag-StrepII
• Expression System: Transfection of pSuper-TNFRSF1A plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
• Form: Liquid