Abnova™ Purified TNFRSF9 (AAH06196.1 24 a.a. - 186 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells

Catalog No.	Quantity
89-953-506	25 μg

Catalog No. 89-953-506 Supplier Abnova™ Supplier No. H00003604H03

Description

Used for ELISA, PI, SDS-PAGE, WB

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq]

Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Specifications

• Accession Number: AAH06196.1
• Concentration: ≥ 10 ug/ml
• For Use With (Application): ELISA, Protein Interaction, SDS-PAGE, Western Blot
• Formulation: Liquid
• Gene ID (Entrez): 3604
• Molecular Weight (g/mol): 23.21kDa
• Name: TNFRSF9 (Human) Recombinant Protein
• Preparation Method: Transfection of pSuper-TNFRSF9 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
• Purification Method: Strep-Tactin affinity columns
• Quality Control Testing: SDS-PAGE and Western Blot
• Quantity: 25 μg
• Immunogen: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: 4-1BB/CD137/CDw137/ILA/MGC2172
• Common Name: TNFRSF9
• Gene Symbol: TNFRSF9
• Biological Activity: Not Tested
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-Flag-StrepII
• Expression System: Transfection of pSuper-TNFRSF9 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
• Form: Liquid