Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ PUS1 Recombinant Protein Antigen

Click to view available options
Quantity:
100 μL
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PUS1. Source: E.coli Amino Acid Sequence: LKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQ The PUS1 Recombinant Protein Antigen is derived from E. coli. The PUS1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
Gene ID (Entrez) | 80324 |
Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
Common Name | PUS1 Recombinant Protein Antigen |
Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
Formulation | PBS and 1M Urea, pH 7.4. |
For Use With (Application) | Blocking/Neutralizing, Control |
Gene Alias | EC 5.4.99.12, MGC11268, mitochondrial tRNA pseudouridine synthase A, MLASA1, pseudouridylate synthase 1, tRNA pseudouridine synthase A, mitochondrial, tRNA pseudouridylate synthase I, tRNA uridine isomerase I, tRNA-uridine isomerase I |
Gene Symbol | PUS1 |
Label Type | Unlabeled |
Product Type | Recombinant Protein Antigen |
Show More |
For Research Use Only.
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction