Invitrogen™ RAB18 Polyclonal Antibody

Catalog No.	Quantity
PIPA595323	100 μg

Catalog No. PIPA595323 Supplier Invitrogen™ Supplier No. PA595323

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Testis Tissue, Rat Lung Tissue, 293T whole cell, HELA whole cell, HEPG2 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

Specifications

• Antigen: RAB18
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: Rab18
• Gene Accession No.: Q5EB77, Q9NP72
• Gene Alias: AA959686; GTP-binding protein Rab18; RAB18; RAB18 small GTPase; RAB18, member RAS oncogene family; RAB18LI1; Ras-related protein Rab-18; ras-related protein rab-18-like protein; WARBM3
• Gene Symbols: Rab18
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 22931, 307039
• Target Species: Human, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG