AMPD1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-681	100 μL

Catalog No. 89-123-681 Supplier Abnova Corporation Supplier No. PAB21974

Description

Rabbit polyclonal antibody raised against recombinant AMPD1.

Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. [provided by RefSeq

Sequence: SETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANE

Specifications

• Antigen: AMPD1
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant AMPD1.
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: AMPD1
• Gene Accession No.: P23109
• Gene Alias: MAD/MADA
• Gene Symbols: AMPD1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human AMPD1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 270
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only