Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GMFB, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant GMFB.

Supplier:  Abnova Corporation PAB28621

Catalog No. 89-130-134


Add to Cart

Description

Description

Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Specifications

Specifications

GMFB
Polyclonal
Rabbit polyclonal antibody raised against recombinant GMFB.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
P60983
GMFB
Recombinant protein corresponding to amino acids of human GMFB.
100 μL
Primary
Human, Mouse, Rat
Liquid
Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
GMFB
GMF
Rabbit
Antigen affinity purification
RUO
2764
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only