MAP1A, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant MAP1A.

Supplier:  Abnova Corporation PAB23390

Catalog No. 89-125-089

Description

This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor polypeptide that presumably undergoes proteolytic processing to generate the final MAP1A heavy chain and LC2 light chain. Expression of this gene is almost exclusively in the brain. Studies of the rat microtubule-associated protein 1A gene suggested a role in early events of spinal cord development. [provided by RefSeq

Sequence: SSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKD

Specifications

• Antigen: MAP1A
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant MAP1A.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ77111/MAP1L/MTAP1A
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 4130
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
• Gene: MAP1A
• Gene Symbols: MAP1A
• Immunogen: Recombinant protein corresponding to amino acids of human MAP1A.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only