Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123916

PIP3-E, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89123916 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
Catalog No. Quantity
89-123-916 100 μL
1 options

Catalog No. 89-123-916

Supplier: Abnova Corporation PAB22210

Only null left
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant PIP3-E.

Sequence: LNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRR

Specifications

Antigen PIP3-E
Applications Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant PIP3-E.
Dilution Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene PIP3-E
Gene Alias IPCEF1/KIAA0403/RP3-402L9.2
Gene Symbols PIP3-E
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human PIP3-E.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26034
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.